General Information

  • ID:  hor001037
  • Uniprot ID:  H2L045
  • Protein name:  FMRFamide
  • Gene name:  tns-1
  • Organism:  Caenorhabditis elegans
  • Family:  PTEN phosphatase protein family
  • Source:  Animal
  • Expression:  Expressed in ventral motor neurons, including ventral and dorsal D-type neurons, and in a subset of cells in the head.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004721 phosphoprotein phosphatase activity; GO:0004725 protein tyrosine phosphatase activity; GO:0005515 protein binding; GO:0016787 hydrolase activity
  • GO BP:  GO:0048680 positive regulation of axon regeneration
  • GO CC:  GO:0005925 focal adhesion; GO:0030054 cell junction; GO:0030424 axon; GO:0031430 M band; GO:0042995 cell projection; GO:0055120 striated muscle dense body

Sequence Information

  • Sequence:  FMRF
  • Length:  4(158-161)
  • Propeptide:  MAAAALCCASRKSNKYNNEAGYEVYTISEDQLRLKQKMKDRKEGVQVEYITSRLIVLSCTSETSERKFVESLLKASQQIQNAHNKHIRVWNVSQRRHDISSSLDAIPFGWPSETAPSLEKLCTICKNLDQWMLEHPLNIAVIFCKGGLERCAIVVNAFMRFNAISATDDSVDDRFSMQRFSERFLGPDGPPSYKRYLGYFSSLLSGRISVNSDPLYLHNIILTFFEPINVFLKIYERLVPVYQSKTVALNKSSKF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exert potent physiological effects on locomotory, feeding and reproductive musculature and also act as neuromodulators.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-H2L045-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001037_AF2.pdbhor001037_ESM.pdb

Physical Information

Mass: 65343 Formula: C29H41N7O5S
Absent amino acids: ACDEGHIKLNPQSTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: 75 Boman Index: -661
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: -1135 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15236235
  • Title:  Expression and regulation of an FMRFamide-related neuropeptide gene family in Caenorhabditis elegans